General Information

  • ID:  hor003228
  • Uniprot ID:  O93227
  • Protein name:  Dermorphin
  • Gene name:  NA
  • Organism:  Agalychnis annae (Blue-sided leaf frog) (Phyllomedusa annae)
  • Family:  Frog skin active peptide (FSAP) family, Dermorphin subfamily
  • Source:  animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Agalychnis (genus), Phyllomedusinae (subfamily), Hylidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity
  • GO BP:  GO:0006952 defense response; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YAFGYPS
  • Length:  7
  • Propeptide:  KKIKRETEEDENENEEERNERSEMKRYAFGYPSGEEKKIKRETEEDENENEEERNEEGSEMKRYAFGYPSGEAKRMKRKPAEEETE
  • Signal peptide:  NA
  • Modification:  T2 D-alanine (Ala);T7 Serine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Dermorphin has a very potent opiate-like activity. It has high affinity and selectivity for mu-type opioid receptors (By similarity).
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 1.3 minute; /78 seconds ( PubMed ID: 6522442 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O93227-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003228_AF2.pdbhor003228_ESM.pdb

Physical Information

Mass: 91106 Formula: C40H49N7O11
Absent amino acids: CDEHIKLMNQRTVW Common amino acids: Y
pI: 6.09 Basic residues: 0
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -11.43 Boman Index: 205
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 14.29
Instability Index: 7541.43 Extinction Coefficient cystines: 2980
Absorbance 280nm: 496.67

Literature

  • PubMed ID:  9949868##6522442
  • Title:  opioid neuropeptide precursor family Peptides From Frog Skin